PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_BDECC07BD.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 392aa    MW: 42956.5 Da    PI: 6.8696
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_BDECC07BD.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-1754101148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+WT+eEde+l+  ++++G g+W++ +++ g+ R++k+c++rw +yl
  Traes_2DL_BDECC07BD.2  54 KGPWTPEEDEKLLAHIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNYL 101
                            79********************************************97 PP

2Myb_DNA-binding49.78.4e-16107152148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg+++ +E++ +++++++lG++ W++Ia ++  +Rt++++k++w+++l
  Traes_2DL_BDECC07BD.2 107 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLS-RRTDNEIKNYWNTHL 152
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-2645104IPR009057Homeodomain-like
PROSITE profilePS5129417.32649101IPR017930Myb domain
SuperFamilySSF466891.35E-2951148IPR009057Homeodomain-like
SMARTSM007172.6E-1453103IPR001005SANT/Myb domain
PfamPF002497.1E-1654101IPR001005SANT/Myb domain
CDDcd001673.57E-1256101No hitNo description
PROSITE profilePS5129425.189102156IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-25105156IPR009057Homeodomain-like
SMARTSM007172.6E-15106154IPR001005SANT/Myb domain
PfamPF002497.8E-15107152IPR001005SANT/Myb domain
CDDcd001675.78E-11109152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MLIIHCPNGP ISYQYMFIQL LCTQLSALGF RKAAAYYATP MGRSPCCDKV GLKKGPWTPE  60
EDEKLLAHIE EHGHGSWRAL PSKAGLQRCG KSCRLRWTNY LRPDIKRGKF SLQEEQTIIQ  120
LHALLGNRWS AIATHLSRRT DNEIKNYWNT HLKKRLAKMG IDPVTHKAAS GAPVGTADDV  180
RSAKAAASLS HMAQWESARL EAEGRLARES TMRTAASTPT SITLHPINLP EPTTSPCLGM  240
LQPWQGAKLD LESPTSTLTF IGNNNSVSLG ISEGDPTTCK LRSDDPEREE DSVRKFLRQQ  300
QMQGLEGAER GDEHIIGCEE PWFQGTAGVG AGFTDMLHDA LDCWGESSNG QAELSGQVSG  360
DGESSSSYWS GILGMVVTSE LPPSHPHPPA FL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-255215625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3583250.0AK358325.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1073M23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574525.11e-179PREDICTED: myb-related protein Myb4-like
TrEMBLW5BZP30.0W5BZP3_WHEAT; Uncharacterized protein
STRINGMLOC_58915.40.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-104myb domain protein 16
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]